General Information

  • ID:  hor001004
  • Uniprot ID:  P01350
  • Protein name:  Gastrin-52
  • Gene name:  GAST
  • Organism:  Homo sapiens (Human)
  • Family:  Gastrin/cholecystokinin family
  • Source:  Human
  • Expression:  NA
  • Disease:  Diseases associated with GAST include Gastritis and Zollinger-Ellison Syndrome.
  • Comments:  NA
  • Taxonomy:  Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005515 protein binding
  • GO BP:  GO:0007165 signal transduction; GO:0007186 G protein-coupled receptor signaling pathway; GO:0032094 response to food
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  DLELPWLEQQGPASHHRRQLGPQGPPHLVADPSKKQGPWLEEEEEAYGWMDF
  • Length:  52(41-92)
  • Propeptide:  MQRLCVYVLIFALALAAFSEASWKPRSQQPDAPLGTGANRDLELPWLEQQGPASHHRRQLGPQGPPHLVADPSKKQGPWLEEEEEAYGWMDFGRRSAEDEN
  • Signal peptide:  MQRLCVYVLIFALALAAFSEA
  • Modification:  T19 Pyrrolidone carboxylic acid;T36 Pyrrolidone carboxylic acid;T47 Sulfotyrosine;T52 Phenylalanine amide
  • Glycosylation:  NA
  • Mutagenesis:  46-46A->D: Small increase in ratio of gastrin-17 versus gastrin-34 production. No change in ratio of gastrin-17 versus gastrin-34 production; 47-47A->D: Small increase in ratio of gastrin-17 versus gastrin-34 production. No change in ratio of gastrin-17 v

Activity

  • Function:  Gastrin stimulates the stomach mucosa to produce and secrete hydrochloric acid and the pancreas to secrete its digestive enzymes. It also stimulates smooth muscle contraction and increases blood circulation and water secretion in the stomach and intestine
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  CCKBR
  • Target Unid:   P32239
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P01350-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor001004_AF2.pdbhor001004_ESM.pdb

Physical Information

Mass: 692850 Formula: C271H396N74O81S
Absent amino acids: CINT Common amino acids: EPL
pI: 4.43 Basic residues: 7
Polar residues: 8 Hydrophobic residues: 14
Hydrophobicity: -116.54 Boman Index: -10738
Half-Life / Aliphatic Index: 1.1 hour Aliphatic Index: 56.35
Instability Index: 8593.46 Extinction Coefficient cystines: 17990
Absorbance 280nm: 352.75

Literature

  • PubMed ID:  NA
  • Title:  NA