HORDB

ID: hor001004
Uniprot ID: P01350
Protein name: Gastrin-52
Gene name: GAST
Organism: Homo sapiens (Human)
Family: Gastrin/cholecystokinin family
Source: Human
Expression: NA
Disease: Diseases associated with GAST include Gastritis and Zollinger-Ellison Syndrome.
Comments: NA
Taxonomy: Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005179 hormone activity; GO:0005515 protein binding
GO BP: GO:0007165 signal transduction; GO:0007186 G protein-coupled receptor signaling pathway; GO:0032094 response to food
GO CC: GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence: DLELPWLEQQGPASHHRRQLGPQGPPHLVADPSKKQGPWLEEEEEAYGWMDF
Length: 52
Propeptide: MQRLCVYVLIFALALAAFSEASWKPRSQQPDAPLGTGANRDLELPWLEQQGPASHHRRQLGPQGPPHLVADPSKKQGPWLEEEEEAYGWMDFGRRSAEDEN
Signal peptide: MQRLCVYVLIFALALAAFSEA
Modification: T19 Pyrrolidone carboxylic acid;T36 Pyrrolidone carboxylic acid;T47 Sulfotyrosine;T52 Phenylalanine amide
Glycosylation: NA
Mutagenesis: 46-46A->D: Small increase in ratio of gastrin-17 versus gastrin-34 production. No change in ratio of gastrin-17 versus gastrin-34 production; 47-47A->D: Small increase in ratio of gastrin-17 versus gastrin-34 production. No change in ratio of gastrin-17 v

Function: Gastrin stimulates the stomach mucosa to produce and secrete hydrochloric acid and the pancreas to secrete its digestive enzymes. It also stimulates smooth muscle contraction and increases blood circulation and water secretion in the stomach and intestine.
Mechanism: NA
Cross BBB: NA
Target: CCKBR
Target Unid: P32239
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor001004_AF2.pdb

hor001004_ESM.pdb

Mass:	692850	Formula:	C271H396N74O81S
Absent amino acids:	CINT	Common amino acids:	EPL
pI:	4.43	Basic residues:	7
Polar residues:	8	Hydrophobic residues:	14
Hydrophobicity:	-116.54	Boman Index:	-10738
Half-Life:	1.1 hour	Half-Life Yeast:	3 min
Half-Life E.Coli:	>10 hour	Aliphatic Index	56.35
Instability Index:	8593.46	Extinction Coefficient cystines:	17990
Absorbance 280nm:	352.75